PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_21.185
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family bZIP
Protein Properties Length: 393aa    MW: 43069.4 Da    PI: 6.5936
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_21.185genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1292.3e-09232290563
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                   kr++r   NR +A rs +RK  ++ eLe+kv++L++e ++L  ++ +l+     l++e+
  evm.model.supercontig_21.185 232 KRAKRILANRQSAARSKERKIRYTNELERKVQTLQTEATTLSAQVTMLQRDTTGLTAEN 290
                                   9********************************************99998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-16228292IPR004827Basic-leucine zipper domain
PfamPF077163.9E-8230281IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.059230293IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-11232284No hitNo description
Gene3DG3DSA:1.20.5.1706.0E-11232286No hitNo description
CDDcd147031.28E-22233282No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007231Biological Processosmosensory signaling pathway
GO:0008272Biological Processsulfate transport
GO:0009294Biological ProcessDNA mediated transformation
GO:0009652Biological Processthigmotropism
GO:0009970Biological Processcellular response to sulfate starvation
GO:0045596Biological Processnegative regulation of cell differentiation
GO:0051170Biological Processnuclear import
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
GO:0051019Molecular Functionmitogen-activated protein kinase binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MPLLYLPPLL LSVIDFNESL SSKPSLITEQ HSPPLPPPSP REMEAKLAGT GVSEIEQMPE  60
VPQHRGPHHR RAHSDTSFRC FDDLLLFDPS DLDLSSLDLP PSNPPPPRAS PMAVDSSDES  120
SSNGAPPHAP PPPPSSLPKP PRTISHFRSL SVDSDFFDGF ALTPSVPPPD DSFGGKTSSA  180
GGEKRPYYHR HSNSMDGTSS ASFELDSILG MDGMKKAMAP DRLAELALVD PKRAKRILAN  240
RQSAARSKER KIRYTNELER KVQTLQTEAT TLSAQVTMLQ RDTTGLTAEN KELKLRLQAM  300
EQQAQLRDAL NEALREEVQR LKIAAAQLPA VNGNPFNRVL PPQFPTQQTA LHPFGSQQQQ  360
QQQQAAQIQT LQSSPSNQSL NGQPHPSFMD FN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00184DAPTransfer from AT1G43700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062128.11e-140PREDICTED: transcription factor VIP1
SwissprotQ9MA751e-111VIP1_ARATH; Transcription factor VIP1
TrEMBLA0A059BT811e-140A0A059BT81_EUCGR; Uncharacterized protein
STRINGVIT_18s0076g00330.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79932639
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.17e-83VIRE2-interacting protein 1